Scaffold Ga0066179_10243789

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066179_10243789

Scaffold Ga0066179_10243789

Overview

Basic Information
Taxon OID	3300004126 Open in IMG/M
Scaffold ID	Ga0066179_10243789 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	512
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Haptista	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location Name	Lake Michigan, USA
Coordinates	Lat. (^o)	43.1998	Long. (^o)	-86.5698	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030973	Metagenome / Metatranscriptome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066179_102437891	F030973	N/A	FKPNGFLYTKKMQGDWNNGMLGSRNYSAVRLSEGRHWKGNLYVTNNQVMMKGHANEDVPFGYSKGPGPKFENMQHALAHKSTYLGFYAL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.