| Basic Information | |
|---|---|
| Taxon OID | 3300004101 Open in IMG/M |
| Scaffold ID | Ga0058896_1356374 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 548 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Alismatales → Araceae → Pothoideae → Potheae → Anthurium → Anthurium amnicola | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Harvard Forest LTER, Petersham, MA, USA | |||||||
| Coordinates | Lat. (o) | 42.531427 | Long. (o) | -72.189946 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003556 | Metagenome / Metatranscriptome | 479 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0058896_13563741 | F003556 | N/A | TFLRKRFVPSFTRTFPVPSFGRVVSKLPVRANNNRAVSDENYMAGKLLSAAYEHRHVATVRELLLHTAEQMSSTPFLDFRNQACAYKYTAEELKNLTLDAKTIDPDCFHTFLKKVYGVNEQELVECYTSVCDGILGFQRVNSKRGPQRSKDPILAPKIPRALWDTAFESIVTVDVAL* |
| ⦗Top⦘ |