Basic Information | |
---|---|
Taxon OID | 3300004097 Open in IMG/M |
Scaffold ID | Ga0055584_101106777 Open in IMG/M |
Source Dataset Name | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 828 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium SW_4_49_11 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Helgoland, North Sea, Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 54.18194 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013301 | Metagenome / Metatranscriptome | 272 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0055584_1011067772 | F013301 | N/A | MATVYLPVQPIEGMDSAQRAEALDAETWRLRRPLSLQSPQDVTQFYYPRITHP |
⦗Top⦘ |