Scaffold Ga0062387_100029645

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0062387_100029645

Scaffold Ga0062387_100029645

Overview

Basic Information
Taxon OID	3300004091 Open in IMG/M
Scaffold ID	Ga0062387_100029645 Open in IMG/M
Source Dataset Name	Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2397
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location Name	Calvert Island, British Columbia, Canada
Coordinates	Lat. (^o)	51.62	Long. (^o)	-128.09	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031236	Metagenome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062387_1000296453	F031236	GGAG	MQYLPGFTVQCINVQCDARGQWMRADATNPIGNDGRCPCCGDFLRNV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.