NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063454_100660742

Scaffold Ga0063454_100660742


Overview

Basic Information
Taxon OID3300004081 Open in IMG/M
Scaffold IDGa0063454_100660742 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from Hopland, California, USA - 2 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)778
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Mediterranean Grasslands, California

Source Dataset Sampling Location
Location NameHopland, California
CoordinatesLat. (o)38.99297339Long. (o)-123.0674491Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030071Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0063454_1006607421F030071AGGAGGMYAFVVFVGLALALAVVGQVLDELLPVKAPKALTTTMTVAIAILGAWAIDYSVFTSFGQSLRADWQNPVVTGIVLVGAGEFLRALAGNMGLSISLGNRDRSKAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.