| Basic Information | |
|---|---|
| Taxon OID | 3300004080 Open in IMG/M |
| Scaffold ID | Ga0062385_10614534 Open in IMG/M |
| Source Dataset Name | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 689 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Calvert Island, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 51.62 | Long. (o) | -128.09 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006156 | Metagenome / Metatranscriptome | 380 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0062385_106145341 | F006156 | AGGAGG | MKQLMQQLKYVALLSTLALLSPVGALARDKNQHSVVIPDTVQVGNAQLNPGNYKVEWQGTGPEVQVNFVRNGKTVATVPGTLNANDKRVVQDAIVTDTASNTNTLKEIDFGRDKESVIFGQSGM* |
| ⦗Top⦘ |