NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063233_10002128

Scaffold Ga0063233_10002128


Overview

Basic Information
Taxon OID3300003986 Open in IMG/M
Scaffold IDGa0063233_10002128 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3811
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (54.55%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011754Metagenome / Metatranscriptome287Y
F024537Metagenome / Metatranscriptome205Y
F042301Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0063233_1000212810F042301AGGAGMVKSGSKWIGNGNEKFHVLDVIELEGHTWVHYIKENAPQDTTREYSCYLESFLLRFREYIND*
Ga0063233_100021283F024537GAGGMSIEEEILNKAGKDMAREIDREVLWGMLKDIGWRRVILDRFTDNNHAVDITYWLEANCKNPFERSGADFIFESEVDAVNFTLRWQ*
Ga0063233_100021289F011754AGGAMKMGFSLGRCVRDIVKGSVDINDVAFIIAATSIHDEPQLANVIDQYMNRDDDYLYGLDKDKCQAVALELWSTSKILQPRRQGLHRHRQPENSVWVDMFPTELSENHSVKSAWDAYRFMLHMTENVDNEAVEVFKQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.