Scaffold Ga0063042_125437

Overview

Basic Information

• Taxon OID: 3300003981
• Scaffold ID: Ga0063042_125437
• Source Dataset Name: Diffuse hydrothermal vent microbial communities from Menez Gwen hydrothermal field, Mid Atlantic ridge - MGW_A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Max Planck Institute for Plant Breeding Research
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1116
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Vent → Diffuse Hydrothermal Vent Microbial Communities From Menez Gwen Hydrothermal Field, Mid Atlantic Ridge

Source Dataset Sampling Location

• Location Name: Mid-Atlantic Ridge
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094002	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063042_1254373	F094002	AGTAG	MLEVRIFYASGALECPLPRSPNTTTAIAINTPIAAPNADAAASAIVDMLKVNNI