Scaffold Ga0063042_113846

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063042_113846

Scaffold Ga0063042_113846

Overview

Basic Information
Taxon OID	3300003981 Open in IMG/M
Scaffold ID	Ga0063042_113846 Open in IMG/M
Source Dataset Name	Diffuse hydrothermal vent microbial communities from Menez Gwen hydrothermal field, Mid Atlantic ridge - MGW_A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Max Planck Institute for Plant Breeding Research
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1827
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Vent → Diffuse Hydrothermal Vent Microbial Communities From Menez Gwen Hydrothermal Field, Mid Atlantic Ridge

Source Dataset Sampling Location
Location Name	Mid-Atlantic Ridge
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006321	Metagenome / Metatranscriptome	376	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063042_1138465	F006321	N/A	MAEEKRGIEETKDILDFVFSFVEAVGKAKKDGEMTWSDARYFIDPVKKLFEAVDDIEEVLPEIEDLSEEEYDQLVEYVRGKWNYDEENLDWVVDTAIEAGRGVLTLINMQKS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.