 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300003981 Open in IMG/M |
| Scaffold ID | Ga0063042_108907 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal vent microbial communities from Menez Gwen hydrothermal field, Mid Atlantic ridge - MGW_A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Plant Breeding Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2516 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Vent → Diffuse Hydrothermal Vent Microbial Communities From Menez Gwen Hydrothermal Field, Mid Atlantic Ridge |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid-Atlantic Ridge | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015350 | Metagenome | 255 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063042_1089072 | F015350 | AGG | MKIYKWLIIIVMAILVGWQYDAALQKNLHEVENRIKKFESVDLFNILEQISLAHIESVDILNKKQMELQALEKEIEEKFTIQERELRTQVKTIETKLQKLRSELHDGLTKIERNVSTIDSVVDEKFKTLWMMINNK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |