Scaffold Ga0063600_100004

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063600_100004

Scaffold Ga0063600_100004

Overview

Basic Information
Taxon OID	3300003965 Open in IMG/M
Scaffold ID	Ga0063600_100004 Open in IMG/M
Source Dataset Name	Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39870
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1517647
Total Scaffold Genes	1489 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	238 (15.98%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location Name	Lake Fryxell, Antarctica
Coordinates	Lat. (^o)	-77.611214	Long. (^o)	163.119356	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069970	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063600_10000483	F069970	N/A	MTTQFSKSIKVGDKVTFDNDQIEVFKAETSSTDKAVRQYQQLVLGGIDQVGVVKELGGNLTTVSYPDGWDLPVPTKYLIVLPSE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.