| Basic Information | |
|---|---|
| Taxon OID | 3300003937 Open in IMG/M |
| Scaffold ID | Ga0063391_1002583 Open in IMG/M |
| Source Dataset Name | SPOT_150m_metagenome_year |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Davis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 57699 |
| Total Scaffold Genes | 58 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 35 (60.34%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The San Pedro Channel, Pacific Ocean In The San Pedro Ocean Time-Series (Spot) Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | San Pedro Channel, Pacific | |||||||
| Coordinates | Lat. (o) | 33.55 | Long. (o) | -118.42 | Alt. (m) | Depth (m) | 890 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007391 | Metagenome / Metatranscriptome | 352 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063391_10025839 | F007391 | AGGTGG | MLGGFNALDPKNLIKTAATTGVTYVIAGPLAAAGNAATSIAVDSVLPDDKPAIGDIEAGNEEQLRAYMFQNLTQTVLYAVIGFLIFTNVVGPWAAQRRAKRKAEQVAEDQRRKDKYDAMKAELTARRNKE* |
| ⦗Top⦘ |