Scaffold Ga0063391_1002382

Overview

Basic Information

• Taxon OID: 3300003937
• Scaffold ID: Ga0063391_1002382
• Source Dataset Name: SPOT_150m_metagenome_year
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Davis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 20454
• Total Scaffold Genes: 20
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (15.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The San Pedro Channel, Pacific Ocean In The San Pedro Ocean Time-Series (Spot) Study

Source Dataset Sampling Location

• Location Name: San Pedro Channel, Pacific
• Coordinates
  • Lat. (^o): 33.55
  • Long. (^o): -118.42
  • Depth (m): 890

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033604	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063391_100238217	F033604	N/A	MKRKITVTIDTTYKYVQLWNGIFNLTEKGLQILSAFIDVQIITEEDNFCSVRNKKEVARIVGIKDYNTLNNYIKRFKDKGVVSKKDSKYKLNNLLNPNTSSVEITINK*