Scaffold JGI26437J51864_10005104

Overview

Basic Information

• Taxon OID: 3300003910
• Scaffold ID: JGI26437J51864_10005104
• Source Dataset Name: Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2930
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location

• Location Name: University of Notre Dame, Indiana, USA
• Coordinates
  • Lat. (^o): 41.7
  • Long. (^o): -86.23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033329	Metagenome	177	N

Sequences

Protein ID	Family	RBS	Sequence
JGI26437J51864_100051044	F033329	N/A	MSRDIYNSIEAINASSIKRHFTGSIQYAAGALERGAEFHRNLLETDAKDMPPNARVIYDAIMKHPMLRLVFEKSAKEITFIKEIDIDGRKVAAKGILDLHCPMYSINADIKTTSCTTLRAFASDMTKHYNHIQAVWYSYLTGYSPTNFYYIGVPNKFKGELFIHRHTTEEIDTAENLIREYLEHRGL*