NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063241_1023911

Scaffold Ga0063241_1023911


Overview

Basic Information
Taxon OID3300003894 Open in IMG/M
Scaffold IDGa0063241_1023911 Open in IMG/M
Source Dataset NameMarine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterArgonne National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3680
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities From The Northern Gulf Of Mexico Hypoxic Zone

Source Dataset Sampling Location
Location Namenorthern Gulf of Mexico, LA
CoordinatesLat. (o)28.7167Long. (o)-90.8333Alt. (m)Depth (m)16
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007473Metagenome / Metatranscriptome350Y

Sequences

Protein IDFamilyRBSSequence
Ga0063241_10239113F007473N/AMKVIRLISISTFLFMLCLFENYLNTFISLDFGVYLFLISLLYIGTELFNQNFVIPIFLTGILYDSFFSTYYLGLYTSIFLVVVVLSNFLVSRYSRSNVIYTTILSLCLLIYKIPIIFAFDLDYWLIGYLTSIIVNSLIFISLKRALRNNV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.