Scaffold Ga0063241_1009279

Overview

Basic Information

• Taxon OID: 3300003894
• Scaffold ID: Ga0063241_1009279
• Source Dataset Name: Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Argonne National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 20463
• Total Scaffold Genes: 22
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 18 (81.82%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities From The Northern Gulf Of Mexico Hypoxic Zone

Source Dataset Sampling Location

• Location Name: northern Gulf of Mexico, LA
• Coordinates
  • Lat. (^o): 28.7167
  • Long. (^o): -90.8333
  • Depth (m): 16

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076514	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063241_100927914	F076514	AGG	MTIKKLVNDKPLWDDFLEVLDSKIDVVQRRLEQETSIEGVYRAQGEIAALRRLTYLRDEVNA*