| Basic Information | |
|---|---|
| Taxon OID | 3300003894 Open in IMG/M |
| Scaffold ID | Ga0063241_1000416 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Argonne National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 40756 |
| Total Scaffold Genes | 59 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 52 (88.14%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities From The Northern Gulf Of Mexico Hypoxic Zone |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | northern Gulf of Mexico, LA | |||||||
| Coordinates | Lat. (o) | 28.7167 | Long. (o) | -90.8333 | Alt. (m) | Depth (m) | 16 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031646 | Metagenome | 182 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063241_100041624 | F031646 | GGA | MLKKIIGRLVKKHGMKGLLIMIGDWAVKQSRKESDDEAWEMIIKPFIEENL* |
| ⦗Top⦘ |