NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063012_10017805

Scaffold Ga0063012_10017805


Overview

Basic Information
Taxon OID3300003892 Open in IMG/M
Scaffold IDGa0063012_10017805 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - CP Core 2, 1cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8700
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (53.85%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediment → Hot Spring Sediment Microbial Communities From Chocolate Pots, Yellowstone National Park, Wyoming That Are Fe(Iii) Reducing

Source Dataset Sampling Location
Location NameChocolate Pots Hot Spring, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.427936Long. (o)-110.588466Alt. (m)Depth (m).01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008282Metagenome / Metatranscriptome336Y

Sequences

Protein IDFamilyRBSSequence
Ga0063012_100178051F008282N/AALAVAFVASAMAGAASTAKVMPYEGQIKAIKVDKCGLQPGSCEGSIILARAGGAGEVTLAIKPGTWLKRGDQFVTIDELGVGNYVKVEAVQIPGEPLQRISVLSTP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.