Scaffold Ga0062442_1003014

Overview

Basic Information

• Taxon OID: 3300003888
• Scaffold ID: Ga0062442_1003014
• Source Dataset Name: Freshwater pond sediment microbial communities from Midddleton WI, HM 3/4 enriched by Glucose under anaerobic conditions -HM Sample 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 43197
• Total Scaffold Genes: 52
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 43 (82.69%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions

Source Dataset Sampling Location

• Location Name: Middleton, WI
• Coordinates
  • Lat. (^o): 43.0603
  • Long. (^o): -89.5717

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026006	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062442_10030148	F026006	AGGAGG	MLAYMKKLSTLFVTLSLVLLPVFVSQAAAASIDVPMTTLTISKLGDLTLVVKDGVPQTIVVRGRDVGGSNVSFSINGIPYMGDVSLSNNLTLQPGTMPLMFDHYGKLCFTVGGNVLVLEYNGTAKKTVDTMALTKTLYSKGDFTVADGTGPFAGLKGMKGTYTLTEVCHIVAGEHPKVGSPVEFTFSGM*