| Basic Information | |
|---|---|
| Taxon OID | 3300003886 Open in IMG/M |
| Scaffold ID | Ga0063293_10409943 Open in IMG/M |
| Source Dataset Name | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 927 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiogranum → Thiogranum longum | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents → Black Smoker Hydrothermal Vent Sediment Microbial Communities From The Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid-Atlantic Ridge, South Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -15.160005 | Long. (o) | -13.350021 | Alt. (m) | Depth (m) | 2770 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039145 | Metagenome / Metatranscriptome | 164 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063293_104099432 | F039145 | GGAGG | VKKFLTSLCVSLVLLTGCSQEGVQPPAEIGAFIEELKAEGVDGSLLVRAPFNADMDYVAEYTVARYASTRIISLFKFKDAEKAEVNLQESLRNDKLSGQAVNGRFVMAVTFHPPDEAAVEKIKALFLAHEFE* |
| ⦗Top⦘ |