Basic Information | |
---|---|
Taxon OID | 3300003885 Open in IMG/M |
Scaffold ID | Ga0063294_10427189 Open in IMG/M |
Source Dataset Name | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 803 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents → Black Smoker Hydrothermal Vent Sediment Microbial Communities From The Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mid-Atlantic Ridge, South Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -15.160005 | Long. (o) | -13.350021 | Alt. (m) | Depth (m) | 2770 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087386 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063294_104271891 | F087386 | GGA | MTKEELFKKYSIDESHAEWENGIDNWAGVEVYRIMHDGKLPPLDDLSVIWVCNFLDKQEDMKWWVKNVMSRPQWGSLYLTAKRMVYKFADQILAALEEI* |
⦗Top⦘ |