Scaffold Ga0063294_10018568

Overview

Basic Information

• Taxon OID: 3300003885
• Scaffold ID: Ga0063294_10018568
• Source Dataset Name: Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4681
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents → Black Smoker Hydrothermal Vent Sediment Microbial Communities From The Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Mid-Atlantic Ridge, South Atlantic Ocean
• Coordinates
  • Lat. (^o): -15.160005
  • Long. (^o): -13.350021
  • Depth (m): 2770

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105215	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063294_100185683	F105215	AGGAG	MYIKTGPKNIEGSSRTLLFHQDPDIRLDAAIQLGGDTAGVSDQRLALEALTTALQDPCSTVQEAVLQSLMRMSGKNG*