| Basic Information | |
|---|---|
| Taxon OID | 3300003879 Open in IMG/M |
| Scaffold ID | Ga0063279_1002680 Open in IMG/M |
| Source Dataset Name | Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0107_20120607_metagen |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7312 |
| Total Scaffold Genes | 16 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (31.25%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 35.55167 | Long. (o) | -65.65833 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034767 | Metagenome / Metatranscriptome | 174 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063279_100268011 | F034767 | N/A | MVFGSKIATATYDILRGVNATVWGGVEGAEKAGKIVKTGISGADVVIGTSHALEDFGCNDVVCGTIDVVGSVSSAVGLVLGNIPVTKHLTFITGSVTVGCRSVRYYCKKYGTFWGCTVAAGQGVKEAIKFTVKQ* |
| ⦗Top⦘ |