| Basic Information | |
|---|---|
| Taxon OID | 3300003878 Open in IMG/M |
| Scaffold ID | Ga0063282_1071624 Open in IMG/M |
| Source Dataset Name | Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0142_20120611_metagen |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1732 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 39.978 | Long. (o) | -68.882 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010928 | Metagenome / Metatranscriptome | 297 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063282_10716242 | F010928 | GGA | MGSGQLVDRLTAQVRDRGFAIALLKKRGDMAADGTLTAKGEARNRMTAEERALDRAGETSASATYNPETNRVTKNK* |
| ⦗Top⦘ |