Scaffold Ga0063040_1024290

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063040_1024290

Scaffold Ga0063040_1024290

Overview

Basic Information
Taxon OID	3300003877 Open in IMG/M
Scaffold ID	Ga0063040_1024290 Open in IMG/M
Source Dataset Name	373A_norm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Max Planck Institute for Marine Microbiology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1259
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063710	Metagenome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063040_10242902	F063710	AGGA	MSKPRRRPLHVRVEHEPNRFSDDCLERIYEQLHPTKSRKVTPDKNNEQDEVEPQKGKGGQP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.