| Basic Information | |
|---|---|
| Taxon OID | 3300003877 Open in IMG/M |
| Scaffold ID | Ga0063040_1005516 Open in IMG/M |
| Source Dataset Name | 373A_norm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Marine Microbiology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4171 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063710 | Metagenome | 129 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063040_10055164 | F063710 | AGGA | MNKPRQRSLRVRVEHEPNRFSDDCLERIYEQLHPTKSRKVTPDKNNKPGEVEPQKDKGGWQ* |
| ⦗Top⦘ |