Scaffold Ga0063039_1005005

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063039_1005005

Scaffold Ga0063039_1005005

Overview

Basic Information
Taxon OID	3300003876 Open in IMG/M
Scaffold ID	Ga0063039_1005005 Open in IMG/M
Source Dataset Name	373A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Max Planck Institute for Marine Microbiology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5194
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (12.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051533	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063039_10050053	F051533	GGA	MEDIKTQPMQEKIIVGTSSLKDLAIYLSGVKDGKGSLQPLGTIVLEDLWNAIKYLQGDVRYTCPERDK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.