Scaffold Ga0031658_1088965

Overview

Basic Information

• Taxon OID: 3300003860
• Scaffold ID: Ga0031658_1088965
• Source Dataset Name: Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 554
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location

• Location Name: University of Notre Dame, Indiana, USA
• Coordinates
  • Lat. (^o): 41.7
  • Long. (^o): -86.23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051113	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0031658_10889653	F051113	N/A	DLFTGNKDRKGLLMAGADRAIRELLTIFKDDPIEVPLEEASMSVWSHMQMEE*