Basic Information | |
---|---|
Taxon OID | 3300003852 Open in IMG/M |
Scaffold ID | Ga0031655_10046361 Open in IMG/M |
Source Dataset Name | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1924 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Notre Dame, Indiana, USA | |||||||
Coordinates | Lat. (o) | 41.7 | Long. (o) | -86.23 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008498 | Metagenome / Metatranscriptome | 332 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0031655_100463614 | F008498 | N/A | MPSVTYKNQPAIDANNGSIPLAGTSHIYTVAKVLWPEPIENFLKTLFIGRTIHVCCGKSMLGDVRVDLNEPSADIKCDAQDMREFVKDDEYETSLCDPPYNGKFQWNHNLLKELSRISSRRIIFQHWFLPATPTGLYKKAQNKFALSALYVWQPKTYFGRVQLVSVFDRRTQN* |
⦗Top⦘ |