NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0051980_10046496

Scaffold Ga0051980_10046496


Overview

Basic Information
Taxon OID3300003830 Open in IMG/M
Scaffold IDGa0051980_10046496 Open in IMG/M
Source Dataset NameGroundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2853
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)38.9383Long. (o)-110.1342Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016112Metagenome / Metatranscriptome249N
F016496Metagenome / Metatranscriptome246N
F079604Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0051980_100464963F016112GAGGMWGSIEKVRNICGITKEQINDIVIHDILEQTDRKVRDMVYIYRRLTMQMNKIGTNKIRFDCNKIGDGNMDTSIDSTDISIYHKNEGVYELFAIEKLDILSNEITFQTDIGENYEMLVEYFEDNFHFLIDSLSDASSLLATAMCVRSLPLTPQKDINAKEYERRAKEIIARSSTSFI*
Ga0051980_100464964F016496N/AMEDKIKGRRHLFEKGNKYQLMGSAGLRYGGTTSIAKNKEKNLERLRCGWKPKTLICKDITISDDEEAFAVEFSKKVSEENDTYVDTVLVELAXAQILQVHRVYVYAKDKKISRDASRMIGTVLSTLREMNATKNARKVDNIKVTVNSDIMTLIQQNINHISNDESKKRNNVNTE*
Ga0051980_100464965F079604N/AMTKARRGITLIQNRKKFKLDTFFQDIHKSPVAFMEICHYQGKQVQKFKQTKRLLRLISECDKSIAVLPRGASKSFSFAIIALWYFYTHENFRVAIFSRSHRQSKAVLEICSDIIDSSPLLKTSRQSFQIDQKQRLKSHINSEIIAHPFDASTVLGEHPDIVLADECAFFGDDSFFRKVILPMQSGVR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.