Scaffold Ga0056122_10000490

Overview

Basic Information

• Taxon OID: 3300003817
• Scaffold ID: Ga0056122_10000490
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6014
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (45.45%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Max Planck institute for Marine Microbiology, Germany
• Coordinates
  • Lat. (^o): 51.321602
  • Long. (^o): 12.394572

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020277	Metagenome	225	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0056122_1000049011	F020277	N/A	NGQSEVFYFTANENSEIITNCALTKAVSMLKNKDKIICLPFV*