Scaffold Ga0040879_119519

Overview

Basic Information

• Taxon OID: 3300003730
• Scaffold ID: Ga0040879_119519
• Source Dataset Name: Thermal spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - Beowulf (BE_D) (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 612
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026309	Metagenome / Metatranscriptome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0040879_1195192	F026309	AGGTGG	MSLPAPLNNSDLFIGLIMFIVASILLFTNKIPLSVWTSITGVLLGYYFGYKHGVSESRGG