Scaffold PicMicro_10050185

Overview

Basic Information

• Taxon OID: 3300003702
• Scaffold ID: PicMicro_10050185
• Source Dataset Name: Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3416
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM23-C198 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume

Source Dataset Sampling Location

• Location Name: Mid-Cayman Rise, Caribbean Sea
• Coordinates
  • Lat. (^o): 18.55
  • Long. (^o): 81.716667
  • Depth (m): 5000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081211	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
PicMicro_100501852	F081211	N/A	MNNVATIATIVPLIIVGIGLIGWVLSLRSDVTTAVVQLEAIHEEAESLKERLNTLEKNLAIADDQMNTIMGEHEVIGEMFQRMGEIQPAGERRTYGGYTN*