| Basic Information | |
|---|---|
| Taxon OID | 3300003702 Open in IMG/M |
| Scaffold ID | PicMicro_10004414 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12527 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid-Cayman Rise, Caribbean Sea | |||||||
| Coordinates | Lat. (o) | 18.55 | Long. (o) | 81.716667 | Alt. (m) | Depth (m) | 5000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009560 | Metagenome / Metatranscriptome | 316 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PicMicro_100044147 | F009560 | N/A | MPFKENKKSYMDILFSITTLLKRWHTEIQRKDVDKNYMIKSLTGWIKKLEDLRHEIMMEKDK* |
| ⦗Top⦘ |