Basic Information | |
---|---|
Taxon OID | 3300003702 Open in IMG/M |
Scaffold ID | PicMicro_10001331 Open in IMG/M |
Source Dataset Name | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Michigan |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 25250 |
Total Scaffold Genes | 27 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 24 (88.89%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mid-Cayman Rise, Caribbean Sea | |||||||
Coordinates | Lat. (o) | 18.55 | Long. (o) | 81.716667 | Alt. (m) | Depth (m) | 5000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041250 | Metagenome / Metatranscriptome | 160 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
PicMicro_1000133118 | F041250 | GAG | MGSVNGTMSAVAEHSLVKAATPFVVAALIGVTGWGFSSIMSLQQDMKLLRDGSIHNLEEKVDGLSVRIDEMNKTLTDLRVSLGGRARAGLDL* |
⦗Top⦘ |