Scaffold PicViral_1007331

Overview

Basic Information

• Taxon OID: 3300003690
• Scaffold ID: PicViral_1007331
• Source Dataset Name: Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3015
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume

Source Dataset Sampling Location

• Location Name: Mid-Cayman Rise, Caribbean Sea
• Coordinates
  • Lat. (^o): 53.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050423	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
PicViral_10073314	F050423	AGGTGG	MFKKRTATARICENRLTPIQWSSALFHCGQYVTPPKKAKPIVYSTKSHSRRENFEIYDRTYNRETKKLWEKLVIEIGQGRSYKSLNEWEKMLIQKFGKLIYKA*