| Basic Information | |
|---|---|
| Taxon OID | 3300003690 Open in IMG/M |
| Scaffold ID | PicViral_1006782 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3644 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (77.78%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid-Cayman Rise, Caribbean Sea | |||||||
| Coordinates | Lat. (o) | 53.0 | Long. (o) | Alt. (m) | Depth (m) | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040057 | Metagenome | 162 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PicViral_10067824 | F040057 | GGA | MKPKIEDTDIIIRRAANGWIVFSSSEYDEGHFIVAVHEEGETEWGEHEALMYLFREHFSGYTQSKNRGGIKLEVREKGYAFEEDEEQK* |
| ⦗Top⦘ |