NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PicViral_1006762

Scaffold PicViral_1006762


Overview

Basic Information
Taxon OID3300003690 Open in IMG/M
Scaffold IDPicViral_1006762 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3033
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume

Source Dataset Sampling Location
Location NameMid-Cayman Rise, Caribbean Sea
CoordinatesLat. (o)53.0Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009536Metagenome / Metatranscriptome316Y
F045144Metagenome / Metatranscriptome153Y
F080498Metagenome115Y

Sequences

Protein IDFamilyRBSSequence
PicViral_100676210F045144GGALSWSKGLYHHINRTGKTIRKYPEGNDPLKQKLFGKTRQCTKCGKRKSTLQFHWKTDYRYKDKVTKRLQRHCGVCRVTQDNEKYSATAEAYLRRRIGTLKSTCHKHRGRKKVLLTADQFYNVWKKQRDKTGLQCPLSGETMTHTLGRGQVLTNISVDRIDSDK
PicViral_10067627F009536AGGAMISSKDVMEQALDLMSGKLKEEIKSNLENPKSYTRLFVKIIDEIDNMKVKLPKFTALKNDVLKINKQTHSKITNEMKYEVPKTQSTLSAGDIDRWLSSAKKGEKLIYYTGSTFDHRSVKEESVFRKARNLAMDYDNIPFKNKKYQYRGSVRGEWGCNYTNIITLVQQKVAALQREKEWDEEKKSYVPGNIISYPIYNYIMIKI*
PicViral_10067629F080498N/AMIKKIIVYHLLLFFVVILFACTPRLQVAPKPTEKDNKFMIQLLRNIITQGMDF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.