Scaffold PicViral_1004453

Overview

Basic Information

• Taxon OID: 3300003690
• Scaffold ID: PicViral_1004453
• Source Dataset Name: Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3537
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume

Source Dataset Sampling Location

• Location Name: Mid-Cayman Rise, Caribbean Sea
• Coordinates
  • Lat. (^o): 53.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099409	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
PicViral_10044535	F099409	N/A	HVSTLVNRAAKLTGNTWYEDEEPSPEGWNIMALGRIWEWASRPTIIDRARAEGLEFHPQVVREVDGIVGSLDGVLSPALAPDHTVAVVEAKSRHSSPSDPRDNWRYMVQSMAYCYMTGCTSLWMPILYLPRRGPPDSPFHLYRIEFAPHQLVENWVMLRNVRDA*