Scaffold Ga0005851_1009480

Overview

Basic Information

• Taxon OID: 3300003684
• Scaffold ID: Ga0005851_1009480
• Source Dataset Name: Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 507
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetes incertae sedis → ac1 cluster → Actinobacteria bacterium BACL2 MAG-120820-bin50 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Sandusky Bay, Ohio, USA
• Coordinates
  • Lat. (^o): 41.474889
  • Long. (^o): -82.854137

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042867	Metagenome / Metatranscriptome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0005851_10094801	F042867	GGAG	MYGAVSDVAPRQVVTPLAVVHTGVACAAVGIDTTVIESSDETATSVKERLNLKVLMSYLVILS