Scaffold Ga0008459J53047_1024693

Overview

Basic Information

• Taxon OID: 3300003683
• Scaffold ID: Ga0008459J53047_1024693
• Source Dataset Name: Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 928
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: Monterey Bay, California, USA
• Coordinates
  • Lat. (^o): 36.25
  • Long. (^o): -122.2099

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103312	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0008459J53047_10246932	F103312	N/A	VVLVLDLSISEKIEAGKGRSLDGYKCNRLHVNMRMGSEHVGFLGELDLSCFLSLGHHMLVLNSHNTTTPGSSEGNVLVEVGGEVALEVGEVGKVFLSDIGEGNAGSGLGVAELSESCFTSDEAEWDVVLSAESWQENHDLEWVNIVGHDDELGFAFLDESGDVVETEFEVEWLWSGVSGSGTLSGFSFSNESVLLLLSGLWGVLGEELEELGGLVLVDGLLELVEGWW*