NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0008459J53047_1018655

Scaffold Ga0008459J53047_1018655


Overview

Basic Information
Taxon OID3300003683 Open in IMG/M
Scaffold IDGa0008459J53047_1018655 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)510
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameMonterey Bay, California, USA
CoordinatesLat. (o)36.25Long. (o)-122.2099Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011001Metatranscriptome296Y

Sequences

Protein IDFamilyRBSSequence
Ga0008459J53047_10186551F011001N/ACPSTTMQIRAAIIGAVVATSAALGTQKKLKLDDDQKVFIESQPVLGAGAGDGALGTCRAIAPQHVSNPNAPNVKVCGTGIKATFYLRAECQAYLHHSREIGKCQTGMPPSTCDSFSPAQDPKFGHYQSYIIEQCPPR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.