| Basic Information | |
|---|---|
| Taxon OID | 3300003668 Open in IMG/M |
| Scaffold ID | LSCM4L_1006169 Open in IMG/M |
| Source Dataset Name | Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Late Sample 5) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3154 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lithgow | |||||||
| Coordinates | Lat. (o) | -33.460524 | Long. (o) | 150.168149 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054136 | Metagenome | 140 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LSCM4L_10061695 | F054136 | GAG | MIENKAQLLANLAYIGSKVEAKTSVYLFAGVAFQWHGLKETTRDIDICCSYEEADRIVSILRMFGRMESVTGINDIHFLRIYLKSFTLQIFIKEIWMGDEYRLLEAADCDALTFGGITFLIPDIKTLLMIKDRQIQALYNEWMKLKGEKCT* |
| ⦗Top⦘ |