Scaffold LSCM3L_1028128

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LSCM3L_1028128

Scaffold LSCM3L_1028128

Overview

Basic Information
Taxon OID	3300003667 Open in IMG/M
Scaffold ID	LSCM3L_1028128 Open in IMG/M
Source Dataset Name	Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2))
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	923
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia

Source Dataset Sampling Location
Location Name	Lithgow State Coal Mine, New South Wales, Australia
Coordinates	Lat. (^o)	-33.460524	Long. (^o)	150.168149	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074840	Metagenome / Metatranscriptome	119	N

Sequences

Protein ID	Family	RBS	Sequence
LSCM3L_10281282	F074840	AGTAGG	MLELNENELAQLNQFIVRHERCFVDNKYELTVHLHIIGTGIGSVYKAECEHCGECINLTDYGCW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.