| Basic Information | |
|---|---|
| Taxon OID | 3300003667 Open in IMG/M |
| Scaffold ID | LSCM3L_1019871 Open in IMG/M |
| Source Dataset Name | Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2)) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1208 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lithgow State Coal Mine, New South Wales, Australia | |||||||
| Coordinates | Lat. (o) | -33.460524 | Long. (o) | 150.168149 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097599 | Metagenome / Metatranscriptome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LSCM3L_10198711 | F097599 | N/A | RGACPNCYPNDSGAMFHNLQEPDMPDDETKGLLKTIADALTRREPAPVQHVNLTEFENLKKELETAKAQTAELANLKQELETLKAEKATAEKDTKWNAMKANLPEGWLGAKEPETRKEFEADPGAFALKVVAFKNTQPQEQQAEGTGATGGSGDAESTEEQKFANMAAEVAKATGIQFV* |
| ⦗Top⦘ |