NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LSCM3L_1013516

Scaffold LSCM3L_1013516


Overview

Basic Information
Taxon OID3300003667 Open in IMG/M
Scaffold IDLSCM3L_1013516 Open in IMG/M
Source Dataset NameLithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2))
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1623
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia

Source Dataset Sampling Location
Location NameLithgow State Coal Mine, New South Wales, Australia
CoordinatesLat. (o)-33.460524Long. (o)150.168149Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049017Metagenome / Metatranscriptome147N

Sequences

Protein IDFamilyRBSSequence
LSCM3L_10135162F049017N/AMAIAKYSKTCGKNVPGNSRLFFVEAGNISSITVTSNEISAVTMSDTTKFREFGADIDSIKFTIEGTGSASYSEVQKLEAKFSKKTTALITAKNSLLDAVACGVAIIRVDNNGSAWLSGYTVKDKNRRAYNKITTNFDTGAKPSDEGTAAYTITLEAEGFDDELPFDTTSNAAIVGGTATFIDYN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.