Basic Information | |
---|---|
Taxon OID | 3300003667 Open in IMG/M |
Scaffold ID | LSCM3L_1009790 Open in IMG/M |
Source Dataset Name | Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2)) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2098 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lithgow State Coal Mine, New South Wales, Australia | |||||||
Coordinates | Lat. (o) | -33.460524 | Long. (o) | 150.168149 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003987 | Metagenome / Metatranscriptome | 458 | Y |
F004383 | Metagenome / Metatranscriptome | 440 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LSCM3L_10097905 | F004383 | GGTGG | MPADENPLERAFMARIRADEYREALAALQQEFDERPDVIEIKRQIERCEEERRQCIAQARAAGISKMGNYLLKIRTRKQRTVIPKLFFAKHGAEAFVACATIAIGKAEALLGKSALDDCCEVEVKEIGVSVEYERPEAVE* |
LSCM3L_10097906 | F003987 | GGAGG | MIPALPCGTYSDGDTPAGAFYVAAFEDGDQTHHVGEYRIETLVRALRALQACGYDDVEVGSIERDGKTHLLLIGLDGEAWFGDRQLGCIAVLPVGVE |
⦗Top⦘ |