Scaffold JGI25404J52841_10079831

Overview

Basic Information

• Taxon OID: 3300003659
• Scaffold ID: JGI25404J52841_10079831
• Source Dataset Name: Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 683
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location

• Location Name: University of Puerto Rico, San Juan, Puerto Rico
• Coordinates
  • Lat. (^o): 18.402889
  • Long. (^o): -66.050054

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098117	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
JGI25404J52841_100798311	F098117	N/A	LLLAPAAVRAEEEERFDHRGALGLLVGGGIDFKREVKSGGETEEGRRALLETLLTFPLGVSGNEWTVGARTGFGGSAVDVAIAGGLRAYFGEERFKTYLTAELSMHVTPNVTAGPRLGIGIQYELLPVFGLYLGGGAEVTAGQGIRIAAAVVGGF