NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BLZD_1011271

Scaffold BLZD_1011271


Overview

Basic Information
Taxon OID3300003641 Open in IMG/M
Scaffold IDBLZD_1011271 Open in IMG/M
Source Dataset NameBelize Diploria
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)537
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease

Source Dataset Sampling Location
Location NameBelize: Carrie Bow Cay Field Station
CoordinatesLat. (o)16.80288Long. (o)-88.08213Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086595Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
BLZD_10112712F086595N/AMDKDQTTTPGTTCPTLYDECVGSLTSPASHYSEDAGDGLSSLFEKTRISNHLQMPLQRQHILLSYFKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.