| Basic Information | |
|---|---|
| Taxon OID | 3300003623 Open in IMG/M |
| Scaffold ID | CR30sep_10285 Open in IMG/M |
| Source Dataset Name | Hypersaline viral communities from Bras del Port, Santa Pola, Spain - CR30 Febrero14 septiembre precorrection |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Lifesequencing S.L. |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 629 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bras del Port, Santa Pola, Alicante, Spain | |||||||
| Coordinates | Lat. (o) | 38.192206 | Long. (o) | -0.591865 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062297 | Metagenome | 131 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| CR30sep_102851 | F062297 | N/A | CPRRYTVLAERTEDGRVVEQSVTGQSRAEELFERWDEGEQLCNLRVKAISAPMDDVTRHFEHDWPPTNNSPVSSADDGSTETATKRWETR* |
| ⦗Top⦘ |